PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG258400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 311aa    MW: 34914.2 Da    PI: 6.7806
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG258400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS75.41e-231812992123
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL+ cA+av+ +d+++a++lL++++++as++gd +qRla++f+++L+arl++++s+l + l+ ++ s    +e l+a++l+  ++ + 
  Pavir.3NG258400.1.p 181 RTLLILCAQAVAVNDHTRARELLKQIKQHASETGDVTQRLAQCFAKGLEARLVGTGSQLWQLLKEERLS---IVEFLKAHNLYMAACCFN 267
                          789*********************************************************999999998...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGl 123
                          k+       ++++a+ ge+++Hi+D+++s+G+
  Pavir.3NG258400.1.p 268 KVVLDFSIMTVMKAMVGERKLHIVDYGMSYGF 299
                          *****************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.233154310IPR005202Transcription factor GRAS
PfamPF035143.6E-21181299IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEDDIDDKIS DHPALLRMQQ PFAKILSSTF GTNNADTERA NDLLHGGSGD ALNSALPEGT  60
NSMGAFLKDM EESSVLFPRE NIFRREELAN QMPSESSNKS RFMKMYNRYG NLEEVRTSKA  120
AMAIKVLEDT CVHEMLDDMM LCGHEICIRD IEKLRISMAN EVENSRNRGG RKVVSNVVDI  180
RTLLILCAQA VAVNDHTRAR ELLKQIKQHA SETGDVTQRL AQCFAKGLEA RLVGTGSQLW  240
QLLKEERLSI VEFLKAHNLY MAACCFNKVV LDFSIMTVMK AMVGERKLHI VDYGMSYGFC  300
RGMQIHSRVA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.11e-122PREDICTED: scarecrow-like protein 33
TrEMBLK3YDM31e-122K3YDM3_SETIT; Uncharacterized protein
STRINGSi012328m1e-122(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4140623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.16e-37SCARECROW-like 14